RID: H3XRGFXY014 Job Title:(23) - sp|P0DTC2|SPIKE_SARS2 Spike glycoprotein OS=Severe... Program: BLASTP Query: sp|P0DTC2|SPIKE_SARS2 Spike glycoprotein OS=Severe acute respiratory syndrome coronavirus 2 OX=2697049 GN=S PE=1 SV=1 ID: lcl|Query_5406992(amino acid) Length: 1273 Database: nr All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Sequences producing significant alignments: Sequences with E-value BETTER than threshold Scientific Common Max Total Query E Per. Acc. Description Name Name Taxid Score Score cover Value Ident Len Accession Sequences with E-value WORSE than threshold Scientific Common Max Total Query E Per. Acc. Description Name Name Taxid Score Score cover Value Ident Len Accession polyprotein, partial [Multiple sclerosis associated retrovirus] Multiple scl... NA 62805 25.5 25.5 3% 0.052 32.56 768 AAB66528.1 Alignments: >polyprotein, partial [Multiple sclerosis associated retrovirus] Sequence ID: AAB66528.1 Length: 768 Range 1: 196 to 236 Score:25.5 bits(51), Expect:0.052, Method:Compositional matrix adjust., Identities:14/43(33%), Positives:21/43(48%), Gaps:3/43(6%) Query 136 CNDPFLGVYYHKNNKSW-MESEFRVYSSANNCTFEYVSQPFLM 177 CN P LGV K N W + + R+ + A + VS P+ + Sbjct 196 CNTPILGV--RKPNGQWRLVQDLRIINEAVFPLYPAVSSPYTL 236